PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_016637-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family SRS
Protein Properties Length: 311aa    MW: 33210.9 Da    PI: 8.329
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_016637-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702228.31.4e-70922373153
         DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskk 98 
                     g++sCqdCGnqakkdC+h+RCRtCCksrgf+C+thvkstWvpa++rrerqqqlaa ++++ ++ + +++kr+re+   ++s+l++t+l++++s  
  NNU_016637-RA  92 GGGMSCQDCGNQAKKDCVHMRCRTCCKSRGFQCQTHVKSTWVPASRRRERQQQLAAVEQQQ-QQLRGENPKRQREN--PSASSLACTRLPTTTSG- 183
                    5789**************************************************9986655.66788888999987..789999****9999765. PP

         DUF702  99 eletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                     le+ ++P+ev+s+avfrcvrvs++d++++++aYqtav+i GhvfkGiLydqG+e
  NNU_016637-RA 184 -LEVGNFPAEVNSPAVFRCVRVSAMDEADAQYAYQTAVNIRGHVFKGILYDQGPE 237
                    .88999***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.9E-6694237IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016237.8E-2896138IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.0E-26189236IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MAGFSLGGGG GGGGNQQQHN EIPPESLFLY RNEEISYNKG FELWQQHLHQ RHGQQDIYSS  60
ALGVGPSRSA NISDESPSRA ALVMMRQGGS GGGGMSCQDC GNQAKKDCVH MRCRTCCKSR  120
GFQCQTHVKS TWVPASRRRE RQQQLAAVEQ QQQQLRGENP KRQRENPSAS SLACTRLPTT  180
TSGLEVGNFP AEVNSPAVFR CVRVSAMDEA DAQYAYQTAV NIRGHVFKGI LYDQGPEGHY  240
VPGESSSGGG GIPLNLITAG TAATTTTTTT NVSTSTAAAS AAAALLDPSS LYPTPLNAFM  300
AGTQFFPHPR S
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010271515.10.0PREDICTED: protein SHI RELATED SEQUENCE 1-like
SwissprotQ9SD402e-94SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLA0A061DFV61e-142A0A061DFV6_THECC; Lateral root primordium protein-related, putative
STRINGVIT_04s0023g02780.t011e-119(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.12e-73Lateral root primordium (LRP) protein-related